HomeAll softwareProductsNew ProductsServicesManagement teamCorporate ProfileContact

Test online

Gene finding
Gene finding with similarity
Gene finding in Bacteria
Gene finding in Viruses
Next Generation
Gene search
Gene explorer
Promoter
Protein location
RNA structure
Protein structure
3d-explorer
SeqMan
Multiple alignment
Analysis of expression data
Plant promoter database
Search and map repeats
Extracting known SNPs

 

 

PSITE Program Description
PSITE - Search for of prosite patterns with statistical estimation

Method description:

The method is based on statistical estimation of expected number of a prosite pattern in a given sequence. It uses the PROSITE database (author: Amos Bairoch,1995) of functional motifs. If we found a pattern which has expected number significantly less than 1, it can be supposed that the analyzed sequence possesses the pattern function. Presented version 1 is the simplest version that search for patterns without any deviation from a given Prosite consensus. In the following version we will include this possibility. In the output of PSITE we can see a prosite pattern, its position in the sequence, accession number, ID, Description in the PROSITE database as well as Document number where is pattern characteristics outlined. It must be noted that patterns which started at the beginning or end of protein sequence will be recognized along the whole sequence in this version. It may be useful for analysis of ORF or 6 frame translation sequences.

Acknowledgments: We acknowledge Ilgam Shahmuradov and Igor Rogozin which took part in development some applications of this method for nucleotide consensuses searching and Asya Salihova for protein sites searching on IBM PC.

Example of PSITE output:

 PSITE V1 - search for Prosite patterns
         10        20        30        40        50        60
 RLLRAIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRDNMLRGTEIGVLAKTFIDQGKLI
         70        80        90       100       110       120
 PDDVMTRLVLHELKN*TQYNWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLT
        130       140       150       160       170       180
 ARWIHPGSGRVYNIEFNPPKTMGIDDLTGEPLVQREDDRPETVVKRLKAYEAQTEPVLEY
        190       200       210       220       230       240
 YRKKGVLETFSYTETNKIWPHVYAFLQTKLPDANKDDALDQREWSAAAAWLAAAAALDLN
        250       260       270       280       290       300
 AGCPAAALAAAAAGSAACAAAAAFAAAAAACCAACAAAAAAACAAAADAACGAYAYACAP

ID   GLYCOSAMINOGLYCAN; RULE.
AC   PS00002;
DE   Glycosaminoglycan attachment site.
DO   PDOC00002;
PA   S-G-x-G.
 Sites found:  1 Expected number:   0.0272 95% confidential interval:   0
  #  Start  End  Expected  Site sequence
  1    12    15   0.0272  SGKG
ID   EF_HAND; PATTERN.
AC   PS00018;
DE   EF-hand calcium-binding domain.
DO   PDOC00018;
PA   D-x-[DNS]-{ILVFYW}-[DENSTG]-[DNQGHRK]-{GP}-[LIVMC]-[DENQSTAGC]-x(2)-
PA   [DE]-[LIVMFYW].
 Sites found:  1 Expected number:   0.0004 95% confidential interval:   0
  #  Start  End  Expected  Site sequence
  1   212   224   0.0004  DANKDDALDQREW
ID   ADENYLATE_KINASE; PATTERN.
AC   PS00113;
DE   Adenylate kinase signature.
DO   PDOC00104;
PA   [LIVMFYW](3)-D-G-[FY]-P-R-x(3)-[NQ].
 Sites found:  1 Expected number:   0.0000 95% confidential interval:   0
  #  Start  End  Expected  Site sequence
  1    81    92   0.0000  WLLDGFPRTLPQ

Reference:

Solovyev V.V., Kolchanov N.A. 1994,
Search for functional sites using consensus
In Computer analysis of Genetic macromolecules. (eds. Kolchanov N.A., Lim H.A.), World Scientific, p.16-21.

© 2020 www.softberry.com