HomeAll softwareProductsNew ProductsServicesManagement teamCorporate ProfileContact

Test online

Gene finding
Gene finding with similarity
Gene finding in Bacteria
Gene finding in Viruses
Next Generation
Gene search
Gene explorer
Promoter
Protein location
RNA structure
Protein structure
3d-explorer
SeqMan
Multiple alignment
Analysis of expression data
Plant promoter database
Search and map repeats
Extracting known SNPs

 

 

FEX Program Description
FEX - (find exons) - Prediction of internal, 5'- and 3'- exons in Human DNA sequences

Version 2

Method description:

Algorithm first predicts all internal exons in a given sequence by linear discriminant function combining characteristics describing donor and acceptor splice sites, 5'- and 3'-intron regions and also coding regions for each open reading frame flanked by GT and AG base pairs. Potential 5'- and 3'- exons are predicted by corresponding discriminant functions on the left side of the first internal exon and on the right side from last internal exon, respectively.

Accuracy:

The accuracy of precise exon recognition on the set of 210 genes (with 761 internal exons) is 70% with a specificity of 63%. The recognition quality computed at the level of individual nucleotides is 87% for exons sequences (Sp=82%) with the level 97% for intron sequences. This program does not assemble the exons and is more reliable for a case of missing exons - for example, due to sequencing errors.

FEX output:

First line - name of your sequence
Next lines - positions of predicted exons, their 'weights', ORF number and potential number ORFs for a particular exon.

For example:

Seq name: Adh_and_cact.1 (2919020 bases) 848501 853000 
 Length of sequence:  4500  Exon thr-  0 Overlap thr-    0.0
  # of potential exons: 9
  2758 -    2936 + w=   27.96 ORF= 0 First    exon     2758 -    2934
  3291 -    3354 - w=   13.63 ORF= 2 First    exon     3292 -    3354
  2577 -    2690 + w=   11.78 ORF= 2 Internal exon     2579 -    2689
     3 -     269 + w=   10.06 ORF= 0 Single   exon        3 -     269
  3024 -    3107 - w=    9.15 ORF= 2 Internal exon     3025 -    3105
   385 -     543 + w=    2.22 ORF= 0 Last     exon      385 -     543
  3169 -    3173 + w=    2.18 ORF= 0 First    exon     3169 -    3171
  2213 -    2380 + w=    1.65 ORF= 0 Last     exon     2213 -    2380
  1037 -    1076 + w=    0.25 ORF= 0 First    exon     1037 -    1075
>Exon-     1 Amino acid sequence -    59 aa, chain +
MANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITR
>Exon-     2 Amino acid sequence -    21 aa, chain -
MACAELRTRRRSDRADPPGCS
>Exon-     3 Amino acid sequence -    37 aa, chain +
PNMTAAPYNYNYIFKYIIIGDMGVGKSCLLHQFTEKK
>Exon-     4 Amino acid sequence -    88 aa, chain +
MLVQTPGISKSWMSSICLRESTFFMSCDRFRRSVSHCEGDTHELTAWQRVYLATHIWHRL
AGAQVVDLHIVNFVYEHLEGRFLLKIKT
>Exon-     5 Amino acid sequence -    27 aa, chain -
NLPSALQIRFVANEKDHSAGIGEIASV
>Exon-     6 Amino acid sequence -    52 aa, chain +
CDRRKPSKTRERKSSEKRLLICIDLPIENNRNNCLSVQPRNPAKPVCVLARK
>Exon-     7 Amino acid sequence -     1 aa, chain +
M
>Exon-     8 Amino acid sequence -    55 aa, chain +
LAGKQTRSAVQTQAGLKKKYRGQFEKGEQNVVSTQNKLMQRLGLLISSDYGWTFK
>Exon-     9 Amino acid sequence -    13 aa, chain +
MVGQKRPPLYLKI

Reference:

Solovyev V.V.,Salamov A.A., Lawrence C.B.
Predicting internal exons by oligonucleotide composition and discriminant analysis of spliceable open reading frames.
(Nucl.Acids Res.,1994,22,24,5156-5163).

Solovyev V.V., Salamov A.A. , Lawrence C.B.
The prediction of human exons by oligonucleotide composition and discriminant analysis of spliceable open reading frames.
in: The Second International conference on Intelligent systems for Molecular Biology (eds. Altman R., Brutlag D., Karp R., Latrop R. and Searls D.), AAAI Press, Menlo Park, CA (1994, 354-362)

© 2020 www.softberry.com